ELISA Recombinant Adiantum capillus-veneris ATP synthase subunit a, chloroplastic(atpI)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Adiantum capillus-veneris (Maidenhair fern) Uniprot NO.:Q85FN1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQIEQLQINEIDNLHQVSSVEVGQHLYWQIGNFQVHAQVLITSWVVVAILVALPATTTGN LQSIPTGTQNFIEYVLEFIRDLTRTQMGEEGYRPWVPFIGTMFLFIFASNWSGALLPWRV IQLPHGELAAPTNDINTTVALALLTSVAYFYAGLYKRGFSYFGKYIQPTPILLPINILED FTKPLSLSFRLFGNILADELVVAVLVSLVPLIVPVPMmLLGLFTSGIQALIFATLAAAYI GESMEGHH Protein Names:Recommended name: ATP synthase subunit a, chloroplastic Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit IV Gene Names:Name:atpI Expression Region:1-248 Sequence Info:fµLl length protein