ELISA Recombinant Psychrobacter cryohalolentis UPF0059 membrane protein Pcryo_0007(Pcryo_0007)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Psychrobacter cryohalolentis (strain K5) Uniprot NO.:Q1QEW2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDIEMIEVILLAIALAMDAFAVSIGLGAKSQKQSSAYVLRLAVYAALYFGIAQGVMPLIG YLLGAVLLGWLATAAPWLGGGILILLGAKmLYEAFNGEIEAVLEDSFDRNMQEKINHRMM FTLAIATSIDAMAAGFTLNLLALNAWLACSIIAIVTAGFGFFGIYLGKSSGTWLEDKAEI LGGLVLIAIGIKVMFIR Protein Names:Recommended name: UPF0059 membrane protein Pcryo_0007 Gene Names:Ordered Locus Names:Pcryo_0007 Expression Region:1-197 Sequence Info:fµLl length protein