ELISA Recombinant Desulfovibrio salexigens Protein CrcB homolog(crcB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:DesµLfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) Uniprot NO.:C6BTV9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHKYLYIAAGGAAGSLCRYLVSGVTQRMFATSFPIGTFSVNMIGCLFFGLVTGLFEERLG LPPEMRLLILTGFMGAFTTFSTYMFESTNLIKSGQWAMTALNIGGQSILGFACIVGGLAL GRLIVS Protein Names:Recommended name: Protein CrcB homolog Gene Names:Name:crcB Ordered Locus Names:Desal_1827 Expression Region:1-126 Sequence Info:fµLl length protein