ELISA Recombinant UPF0060 membrane protein HEAR0108 (HEAR0108)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Herminiimonas arsenicoxydans Uniprot NO.:A4G1F7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFELKTVALFVVTAIAEIVGCYLPYLWLRQSGSIWLLLPAALSLALFAWLLSLHPEASGR VYAAYGGIYVAVALGWLWLVDGIKPTNWDVAGVVFTFIGMGIIMFAPRA Protein Names:Recommended name: UPF0060 membrane protein HEAR0108 Gene Names:Ordered Locus Names:HEAR0108 Expression Region:1-109 Sequence Info:fµLl length protein